Lineage for d1s1sb_ (1s1s B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2215445Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
    automatically mapped to Pfam PF04354
  5. 2215446Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)
  6. 2215447Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)
  7. 2215448Species Escherichia coli [TaxId:562] [64386] (6 PDB entries)
  8. 2215455Domain d1s1sb_: 1s1s B: [118843]
    automated match to d1f47b_
    complexed with wac

Details for d1s1sb_

PDB Entry: 1s1s (more details), 2.1 Å

PDB Description: Crystal Structure of ZipA in complex with indoloquinolizin 10b
PDB Compounds: (B:) cell division protein zipa

SCOPe Domain Sequences for d1s1sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1sb_ d.129.4.1 (B:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
keaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmvk
pgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmtp
qklreyqdiirevkdan

SCOPe Domain Coordinates for d1s1sb_:

Click to download the PDB-style file with coordinates for d1s1sb_.
(The format of our PDB-style files is described here.)

Timeline for d1s1sb_: