![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.129: TBP-like [55944] (10 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) ![]() contains a single copy of this fold |
![]() | Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (1 protein) |
![]() | Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64386] (8 PDB entries) |
![]() | Domain d1s1sb1: 1s1s B:7-143 [118843] automatically matched to d1f47b_ complexed with wac |
PDB Entry: 1s1s (more details), 2.1 Å
SCOP Domain Sequences for d1s1sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1sb1 d.129.4.1 (B:7-143) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]} keaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmvk pgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmtp qklreyqdiirevkdan
Timeline for d1s1sb1: