Lineage for d1ryye1 (1ryy E:435-666)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046726Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)
  6. 2046727Protein Alpha-amino acid ester hydrolase [89247] (2 species)
  7. 2046728Species Acetobacter pasteurianus [TaxId:438] [101591] (4 PDB entries)
  8. 2046753Domain d1ryye1: 1ryy E:435-666 [118829]
    Other proteins in same PDB: d1ryya2, d1ryyb2, d1ryyc2, d1ryyd2, d1ryye2, d1ryyf2, d1ryyg2, d1ryyh2
    automated match to d2b9va1
    mutant

Details for d1ryye1

PDB Entry: 1ryy (more details), 2.8 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase y206a mutant
PDB Compounds: (E:) alpha-amino acid ester hydrolase

SCOPe Domain Sequences for d1ryye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryye1 b.18.1.13 (E:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk
pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam
tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv
qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk

SCOPe Domain Coordinates for d1ryye1:

Click to download the PDB-style file with coordinates for d1ryye1.
(The format of our PDB-style files is described here.)

Timeline for d1ryye1: