SCOPe 2.04: Domain d1r86a1: 1r86 A:9-379

Lineage for d1r86a1 (1r86 A:9-379)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Xylanase [51488] (6 species)

7. Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (5 PDB entries)
   Uniprot P40943

8. Domain d1r86a1: 1r86 A:9-379 [118744]
   complexed with cl, so4, zn; mutant

Details for d1r86a1

PDB Entry: 1r86, 1.8 Å

PDB Description: crystal structure of the extracellular xylanase from geobacillus stearothermophilus t-6 (xt6, monoclinic form): the e159a/e265a mutant at 1.8a resolution

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1r86a1:

Sequence; same for both SEQRES and ATOM records:

>d1r86a1 c.1.8.3 (A:9-379) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]}
kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp
eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn
kqlllkrlethiktiverykddikywdvvnavvgddgklrnspwyqiagidyikvafqaa
rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpseaeie
ktinmfaalgldnqitaldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd
kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv
kpaywaiidhk

Timeline for d1r86a1:

• d1r86a1 first appeared in SCOP 1.73
  
• d1r86a1 appears in SCOPe 2.03
  
• d1r86a1 appears in SCOPe 2.05
  
• d1r86a1 appears in the current release, SCOPe 2.08