Lineage for d1r86a1 (1r86 A:9-379)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682589Family c.1.8.3: beta-glycanases [51487] (24 proteins)
    consist of a number of sequence families
  6. 682957Protein Xylanase [51488] (6 species)
  7. 682961Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (4 PDB entries)
  8. 682964Domain d1r86a1: 1r86 A:9-379 [118744]
    complexed with cl, so4, zn; mutant

Details for d1r86a1

PDB Entry: 1r86 (more details), 1.8 Å

PDB Description: Crystal structure of the extracellular xylanase from Geobacillus stearothermophilus T-6 (XT6, monoclinic form): The E159A/E265A mutant at 1.8A resolution
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOP Domain Sequences for d1r86a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r86a1 c.1.8.3 (A:9-379) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]}
kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp
eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn
kqlllkrlethiktiverykddikywdvvnavvgddgklrnspwyqiagidyikvafqaa
rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpseaeie
ktinmfaalgldnqitaldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd
kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv
kpaywaiidhk

SCOP Domain Coordinates for d1r86a1:

Click to download the PDB-style file with coordinates for d1r86a1.
(The format of our PDB-style files is described here.)

Timeline for d1r86a1: