SCOPe 2.07: Domain d1r6oc_: 1r6o C:

Lineage for d1r6oc_ (1r6o C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (3 families)

5. Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)

6. Protein automated matches [190034] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186753] (2 PDB entries)

8. Domain d1r6oc_: 1r6o C: [118738]
   Other proteins in same PDB: d1r6oa_, d1r6ob_
   automated match to d1lzwa_
   complexed with cl, gol, y1, ybt, zn

Details for d1r6oc_

PDB Entry: 1r6o, 2.25 Å

PDB Description: ATP-dependent Clp protease ATP-binding subunit clpA/ATP-dependent Clp protease adaptor protein clpS

PDB Compounds: (C:) ATP-dependent Clp protease adaptor protein clpS

SCOPe Domain Sequences for d1r6oc_:

Sequence, based on SEQRES records:

>d1r6oc_ d.45.1.2 (C:) automated matches {Escherichia coli [TaxId: 562]}
wldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavh
yqgkaicgvftaevaetkvamvnkyarenehpllctleka

Sequence, based on observed residues (ATOM records):

>d1r6oc_ d.45.1.2 (C:) automated matches {Escherichia coli [TaxId: 562]}
wldfdqldalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkai
cgvftaevaetkvamvnkyarenehpllctleka

Timeline for d1r6oc_:

• d1r6oc_ first appeared in SCOP 1.73, called d1r6oc1
  
• d1r6oc_ appears in SCOPe 2.06
  
• d1r6oc_ appears in the current release, SCOPe 2.08