Lineage for d1r6oc_ (1r6o C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190278Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 2190279Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 2190303Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)
  6. 2190324Protein automated matches [190034] (3 species)
    not a true protein
  7. 2190339Species Escherichia coli [TaxId:562] [186753] (2 PDB entries)
  8. 2190340Domain d1r6oc_: 1r6o C: [118738]
    Other proteins in same PDB: d1r6oa_, d1r6ob_
    automated match to d1lzwa_
    complexed with cl, gol, y1, ybt, zn

Details for d1r6oc_

PDB Entry: 1r6o (more details), 2.25 Å

PDB Description: ATP-dependent Clp protease ATP-binding subunit clpA/ATP-dependent Clp protease adaptor protein clpS
PDB Compounds: (C:) ATP-dependent Clp protease adaptor protein clpS

SCOPe Domain Sequences for d1r6oc_:

Sequence, based on SEQRES records: (download)

>d1r6oc_ d.45.1.2 (C:) automated matches {Escherichia coli [TaxId: 562]}
wldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavh
yqgkaicgvftaevaetkvamvnkyarenehpllctleka

Sequence, based on observed residues (ATOM records): (download)

>d1r6oc_ d.45.1.2 (C:) automated matches {Escherichia coli [TaxId: 562]}
wldfdqldalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkai
cgvftaevaetkvamvnkyarenehpllctleka

SCOPe Domain Coordinates for d1r6oc_:

Click to download the PDB-style file with coordinates for d1r6oc_.
(The format of our PDB-style files is described here.)

Timeline for d1r6oc_: