| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
| Protein automated matches [190031] (2 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [186750] (2 PDB entries) |
| Domain d1pk3c_: 1pk3 C: [118717] Other proteins in same PDB: d1pk3a1 automated match to d1kw4a_ complexed with bme |
PDB Entry: 1pk3 (more details), 1.85 Å
SCOPe Domain Sequences for d1pk3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk3c_ a.60.1.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ktranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkym
glklgpalkicnlvnkvn
Timeline for d1pk3c_: