Lineage for d1pk3c_ (1pk3 C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272162Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1272285Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 1272286Protein automated matches [190031] (2 species)
    not a true protein
  7. 1272287Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [186750] (2 PDB entries)
  8. 1272289Domain d1pk3c_: 1pk3 C: [118717]
    Other proteins in same PDB: d1pk3a1
    automated match to d1kw4a_
    complexed with bme

Details for d1pk3c_

PDB Entry: 1pk3 (more details), 1.85 Å

PDB Description: scm sam domain
PDB Compounds: (C:) Sex comb on midleg CG9495-PA

SCOPe Domain Sequences for d1pk3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pk3c_ a.60.1.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ktranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkym
glklgpalkicnlvnkvn

SCOPe Domain Coordinates for d1pk3c_:

Click to download the PDB-style file with coordinates for d1pk3c_.
(The format of our PDB-style files is described here.)

Timeline for d1pk3c_: