SCOPe 2.08: Domain d1pk3c2: 1pk3 C:6-80

Lineage for d1pk3c2 (1pk3 C:6-80)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [186750] (3 PDB entries)

8. Domain d1pk3c2: 1pk3 C:6-80 [118717]
   Other proteins in same PDB: d1pk3a1, d1pk3a2, d1pk3c3
   automated match to d1kw4a_
   complexed with bme

Details for d1pk3c2

PDB Entry: 1pk3, 1.85 Å

PDB Description: scm sam domain

PDB Compounds: (C:) Sex comb on midleg CG9495-PA

SCOPe Domain Sequences for d1pk3c2:

Sequence; same for both SEQRES and ATOM records:

>d1pk3c2 a.60.1.0 (C:6-80) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
anshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkymglk
lgpalkicnlvnkvn

Timeline for d1pk3c2:

• d1pk3c2 first appeared in SCOP 1.73, called d1pk3c1
  
• d1pk3c2 appears in SCOPe 2.07