Lineage for d1pk3c1 (1pk3 C:17-79)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 642791Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 642823Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)
  6. 642856Protein Polycomb protein Scm [140620] (1 species)
  7. 642857Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140621] (2 PDB entries)
  8. 642860Domain d1pk3c1: 1pk3 C:17-79 [118717]
    automatically matched to 1PK3 A:17-79
    complexed with bme; mutant

Details for d1pk3c1

PDB Entry: 1pk3 (more details), 1.85 Å

PDB Description: Scm SAM domain
PDB Compounds: (C:) Sex comb on midleg CG9495-PA

SCOP Domain Sequences for d1pk3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pk3c1 a.60.1.2 (C:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
wtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkymglklgpalkicnlv
nkv

SCOP Domain Coordinates for d1pk3c1:

Click to download the PDB-style file with coordinates for d1pk3c1.
(The format of our PDB-style files is described here.)

Timeline for d1pk3c1: