![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
![]() | Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries) |
![]() | Domain d2lgsg1: 2lgs G:1-100 [118658] Other proteins in same PDB: d2lgsa2, d2lgsb2, d2lgsc2, d2lgsd2, d2lgse2, d2lgsf2, d2lgsg2, d2lgsh2, d2lgsi2, d2lgsj2, d2lgsk2, d2lgsl2 complexed with glu, mn |
PDB Entry: 2lgs (more details), 2.8 Å
SCOPe Domain Sequences for d2lgsg1:
Sequence, based on SEQRES records: (download)
>d2lgsg1 d.15.9.1 (G:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi nesdmvlmpdastavidpffadstliircdilepgtlqgy
>d2lgsg1 d.15.9.1 (G:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv lmpdastavidpffadstliircdilepgtlqgy
Timeline for d2lgsg1: