Lineage for d2lgsc2 (2lgs C:101-468)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192081Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2192082Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2192083Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 protein domains)
  6. 2192084Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 2192134Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)
  8. 2192173Domain d2lgsc2: 2lgs C:101-468 [118651]
    Other proteins in same PDB: d2lgsa1, d2lgsb1, d2lgsc1, d2lgsd1, d2lgse1, d2lgsf1, d2lgsg1, d2lgsh1, d2lgsi1, d2lgsj1, d2lgsk1, d2lgsl1
    complexed with glu, mn

Details for d2lgsc2

PDB Entry: 2lgs (more details), 2.8 Å

PDB Description: feedback inhibition of fully unadenylylated glutamine synthetase from salmonella typhimurium by glycine, alanine, and serine
PDB Compounds: (C:) glutamine synthetase

SCOPe Domain Sequences for d2lgsc2:

Sequence, based on SEQRES records: (download)

>d2lgsc2 d.128.1.1 (C:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

Sequence, based on observed residues (ATOM records): (download)

>d2lgsc2 d.128.1.1 (C:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvppvmlaysarnrsasir
ipvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdipqvagsleea
lnaldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv

SCOPe Domain Coordinates for d2lgsc2:

Click to download the PDB-style file with coordinates for d2lgsc2.
(The format of our PDB-style files is described here.)

Timeline for d2lgsc2: