Lineage for d2lgsd1 (2lgs D:1-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934813Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2934814Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 2934815Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 2934865Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 2934905Domain d2lgsd1: 2lgs D:1-100 [118652]
    Other proteins in same PDB: d2lgsa2, d2lgsb2, d2lgsc2, d2lgsd2, d2lgse2, d2lgsf2, d2lgsg2, d2lgsh2, d2lgsi2, d2lgsj2, d2lgsk2, d2lgsl2
    complexed with glu, mn

Details for d2lgsd1

PDB Entry: 2lgs (more details), 2.8 Å

PDB Description: feedback inhibition of fully unadenylylated glutamine synthetase from salmonella typhimurium by glycine, alanine, and serine
PDB Compounds: (D:) glutamine synthetase

SCOPe Domain Sequences for d2lgsd1:

Sequence, based on SEQRES records: (download)

>d2lgsd1 d.15.9.1 (D:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Sequence, based on observed residues (ATOM records): (download)

>d2lgsd1 d.15.9.1 (D:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
lmpdastavidpffadstliircdilepgtlqgy

SCOPe Domain Coordinates for d2lgsd1:

Click to download the PDB-style file with coordinates for d2lgsd1.
(The format of our PDB-style files is described here.)

Timeline for d2lgsd1: