Lineage for d2ldxb1 (2ldx B:1-159)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579075Protein Lactate dehydrogenase [51859] (18 species)
  7. 1579206Species Mouse (Mus musculus) [TaxId:10090] [51861] (1 PDB entry)
  8. 1579208Domain d2ldxb1: 2ldx B:1-159 [118642]
    Other proteins in same PDB: d2ldxa2, d2ldxb2, d2ldxc2, d2ldxd2
    duplicate of 2LDX 1-159

Details for d2ldxb1

PDB Entry: 2ldx (more details), 2.96 Å

PDB Description: characterization of the antigenic sites on the refined 3-angstroms resolution structure of mouse testicular lactate dehydrogenase c4
PDB Compounds: (B:) apo-lactate dehydrogenase

SCOPe Domain Sequences for d2ldxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ldxb1 c.2.1.5 (B:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}
stvkeqliqnlvpedklsrckitvvgvgdvgmacaisillkgladelalvdadtdklrge
aldlqhgslflstpkivfgkdynvsansklviitagarmvsgqtrldllqrnvaimkaiv
pgviqnspdckiivvtnpvdiltyvvwkisgfpvgrvig

SCOPe Domain Coordinates for d2ldxb1:

Click to download the PDB-style file with coordinates for d2ldxb1.
(The format of our PDB-style files is described here.)

Timeline for d2ldxb1: