Lineage for d1rscn_ (1rsc N:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957807Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries)
  8. 2957821Domain d1rscn_: 1rsc N: [118624]
    Other proteins in same PDB: d1rsca1, d1rsca2, d1rscb1, d1rscb2, d1rscc1, d1rscc2, d1rscd1, d1rscd2, d1rsce1, d1rsce2, d1rscf1, d1rscf2, d1rscg1, d1rscg2, d1rsch1, d1rsch2
    duplicate of 1RSC M
    complexed with xbp

Details for d1rscn_

PDB Entry: 1rsc (more details), 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate
PDB Compounds: (N:) ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)

SCOPe Domain Sequences for d1rscn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rscn_ d.73.1.1 (N:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr

SCOPe Domain Coordinates for d1rscn_:

Click to download the PDB-style file with coordinates for d1rscn_.
(The format of our PDB-style files is described here.)

Timeline for d1rscn_: