Lineage for d1rscg2 (1rsc G:9-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952778Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2952779Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2952955Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [54973] (2 PDB entries)
  8. 2952970Domain d1rscg2: 1rsc G:9-147 [118617]
    Other proteins in same PDB: d1rsca1, d1rscb1, d1rscc1, d1rscd1, d1rsce1, d1rscf1, d1rscg1, d1rsch1, d1rsci_, d1rscj_, d1rsck_, d1rscl_, d1rscm_, d1rscn_, d1rsco_, d1rscp_
    duplicate of 1RSC A:9-147
    complexed with xbp

Details for d1rscg2

PDB Entry: 1rsc (more details), 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate
PDB Compounds: (G:) ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)

SCOPe Domain Sequences for d1rscg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rscg2 d.58.9.1 (G:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
airslrledirfpvalvkt

SCOPe Domain Coordinates for d1rscg2:

Click to download the PDB-style file with coordinates for d1rscg2.
(The format of our PDB-style files is described here.)

Timeline for d1rscg2: