![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species) |
![]() | Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries) |
![]() | Domain d1rscl_: 1rsc L: [118623] Other proteins in same PDB: d1rsca1, d1rsca2, d1rscb1, d1rscb2, d1rscc1, d1rscc2, d1rscd1, d1rscd2, d1rsce1, d1rsce2, d1rscf1, d1rscf2, d1rscg1, d1rscg2, d1rsch1, d1rsch2 duplicate of 1RSC M complexed with xbp |
PDB Entry: 1rsc (more details), 2.3 Å
SCOPe Domain Sequences for d1rscl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rscl_ d.73.1.1 (L:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]} smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr
Timeline for d1rscl_: