![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
![]() | Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries) |
![]() | Domain d1lgrh1: 1lgr H:1-100 [118541] Other proteins in same PDB: d1lgra2, d1lgrb2, d1lgrc2, d1lgrd2, d1lgre2, d1lgrf2, d1lgrg2, d1lgrh2, d1lgri2, d1lgrj2, d1lgrk2, d1lgrl2 duplicate of 1LGR 1-100 complexed with amp, mn |
PDB Entry: 1lgr (more details), 2.79 Å
SCOPe Domain Sequences for d1lgrh1:
Sequence, based on SEQRES records: (download)
>d1lgrh1 d.15.9.1 (H:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi nesdmvlmpdastavidpffadstliircdilepgtlqgy
>d1lgrh1 d.15.9.1 (H:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv lmpdastavidpffadstliircdilepgtlqgy
Timeline for d1lgrh1: