PDB entry 1lgr

View 1lgr on RCSB PDB site
Description: interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium
Class: ligase(amide synthetase)
Keywords: ligase(amide synthetase)
Deposited on 1994-08-05, released 1994-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.233
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgra1, d1lgra2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgrb1, d1lgrb2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgrc1, d1lgrc2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgrd1, d1lgrd2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgre1, d1lgre2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgrf1, d1lgrf2
  • Chain 'G':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgrg1, d1lgrg2
  • Chain 'H':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgrh1, d1lgrh2
  • Chain 'I':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgri1, d1lgri2
  • Chain 'J':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgrj1, d1lgrj2
  • Chain 'K':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgrk1, d1lgrk2
  • Chain 'L':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgrl1, d1lgrl2
  • Heterogens: MN, AMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lgrA (A:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrA (A:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lgrB (B:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrB (B:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lgrC (C:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrC (C:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lgrD (D:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrD (D:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lgrE (E:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrE (E:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lgrF (F:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrF (F:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1lgrG (G:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrG (G:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1lgrH (H:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrH (H:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1lgrI (I:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrI (I:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1lgrJ (J:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrJ (J:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1lgrK (K:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrK (K:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1lgrL (L:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgrL (L:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv