Lineage for d1lgrk1 (1lgr K:1-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934813Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2934814Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 2934815Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 2934865Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 2934900Domain d1lgrk1: 1lgr K:1-100 [118547]
    Other proteins in same PDB: d1lgra2, d1lgrb2, d1lgrc2, d1lgrd2, d1lgre2, d1lgrf2, d1lgrg2, d1lgrh2, d1lgri2, d1lgrj2, d1lgrk2, d1lgrl2
    duplicate of 1LGR 1-100
    complexed with amp, mn

Details for d1lgrk1

PDB Entry: 1lgr (more details), 2.79 Å

PDB Description: interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium
PDB Compounds: (K:) glutamine synthetase

SCOPe Domain Sequences for d1lgrk1:

Sequence, based on SEQRES records: (download)

>d1lgrk1 d.15.9.1 (K:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Sequence, based on observed residues (ATOM records): (download)

>d1lgrk1 d.15.9.1 (K:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
lmpdastavidpffadstliircdilepgtlqgy

SCOPe Domain Coordinates for d1lgrk1:

Click to download the PDB-style file with coordinates for d1lgrk1.
(The format of our PDB-style files is described here.)

Timeline for d1lgrk1: