Lineage for d1bcfc_ (1bcf C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766114Protein Bacterioferritin (cytochrome b1) [47244] (4 species)
    binds heme between two subunits; 24-mer
  7. 766189Species Escherichia coli [TaxId:562] [47245] (3 PDB entries)
  8. 766224Domain d1bcfc_: 1bcf C: [118423]
    duplicate of 1BCF A
    complexed with hem, mn

Details for d1bcfc_

PDB Entry: 1bcf (more details), 2.9 Å

PDB Description: the structure of a unique, two-fold symmetric, haem-binding site
PDB Compounds: (C:) bacterioferritin

SCOP Domain Sequences for d1bcfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcfc_ a.25.1.1 (C:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOP Domain Coordinates for d1bcfc_:

Click to download the PDB-style file with coordinates for d1bcfc_.
(The format of our PDB-style files is described here.)

Timeline for d1bcfc_: