SCOP 1.71: Domain d2bemc_: 2bem C:

Lineage for d2bemc_ (2bem C:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Chitin-binding protein CBP21 [117045] (1 species)
   member of Pfam 03067; elaborated fold with a large insertion between strands A and A'

7. Species Serratia marcescens [TaxId:615] [117046] (2 PDB entries)

8. Domain d2bemc_: 2bem C: [116700]
   complexed with egl, na, so4

Details for d2bemc_

PDB Entry: 2bem, 1.55 Å

PDB Description: crystal structure of the serratia marcescens chitin-binding protein cbp21

SCOP Domain Sequences for d2bemc_:

Sequence; same for both SEQRES and ATOM records:

>d2bemc_ b.1.18.2 (C:) Chitin-binding protein CBP21 {Serratia marcescens}
hgyvespasrayqcklqlntqcgsvqyepqsveglkgfpqagpadghiasadkstffeld
qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk

Timeline for d2bemc_:

• d2bemc_ is new in SCOP 1.71
  
• d2bemc_ appears in SCOP 1.73
  
• d2bemc_ appears in the current release, SCOPe 2.08