Lineage for d2bemb_ (2bem B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 552070Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 552090Protein Chitin-binding protein CBP21 [117045] (1 species)
    member of Pfam 03067; elaborated fold with a large insertion between strands A and A'
  7. 552091Species Serratia marcescens [TaxId:615] [117046] (2 PDB entries)
  8. 552093Domain d2bemb_: 2bem B: [116699]

Details for d2bemb_

PDB Entry: 2bem (more details), 1.55 Å

PDB Description: crystal structure of the serratia marcescens chitin-binding protein cbp21

SCOP Domain Sequences for d2bemb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bemb_ b.1.18.2 (B:) Chitin-binding protein CBP21 {Serratia marcescens}
hgyvespasrayqcklqlntqcgsvqyepqsveglkgfpqagpadghiasadkstffeld
qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk

SCOP Domain Coordinates for d2bemb_:

Click to download the PDB-style file with coordinates for d2bemb_.
(The format of our PDB-style files is described here.)

Timeline for d2bemb_: