SCOP 1.73: Domain d1yeyc2: 1yey C:2-140

Lineage for d1yeyc2 (1yey C:2-140)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein RTS beta protein [117929] (1 species)

7. Species Xanthomonas campestris pv. campestris [TaxId:340] [117930] (1 PDB entry)

8. Domain d1yeyc2: 1yey C:2-140 [116669]
   Other proteins in same PDB: d1yeya1, d1yeyb1, d1yeyc1, d1yeyd1

Details for d1yeyc2

PDB Entry: 1yey, 2.34 Å

PDB Description: crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913

PDB Compounds: (C:) L-fuconate dehydratase

SCOP Domain Sequences for d1yeyc2:

Sequence; same for both SEQRES and ATOM records:

>d1yeyc2 d.54.1.1 (C:2-140) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]}
rtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftigrgnd
vqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaaw
dlaaraankplwrfiaelt

Timeline for d1yeyc2:

• d1yeyc2 first appeared in SCOP 1.71
  
• d1yeyc2 appears in SCOP 1.75
  
• d1yeyc2 appears in the current release, SCOPe 2.08