![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins) |
![]() | Protein RTS beta protein [117386] (1 species) |
![]() | Species Xanthomonas campestris pv. campestris [TaxId:340] [117387] (1 PDB entry) |
![]() | Domain d1yeyc1: 1yey C:184-435 [116668] Other proteins in same PDB: d1yeya2, d1yeyb2, d1yeyc2, d1yeyd2 |
PDB Entry: 1yey (more details), 2.34 Å
SCOP Domain Sequences for d1yeyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yeyc1 c.1.11.2 (C:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} gypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaigpdi amavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstgeht qnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcelvqh lamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasiaefs ypdgrfwvedla
Timeline for d1yeyc1: