Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.8: WrbA-like [117474] (3 proteins) |
Protein Trp repressor binding protein WrbA [117475] (3 species) |
Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries) Uniprot Q9RYU4 |
Domain d1ydga_: 1ydg A: [116614] Structural genomics target complexed with so4 |
PDB Entry: 1ydg (more details), 2 Å
SCOPe Domain Sequences for d1ydga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra sirhqvrrqveltaklleggs
Timeline for d1ydga_: