| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.8: WrbA-like [117474] (3 protein domains) |
| Protein Trp repressor binding protein WrbA [117475] (3 species) |
| Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries) Uniprot Q9RYU4 |
| Domain d1ydga_: 1ydg A: [116614] Structural genomics target complexed with so4 |
| PDB Entry: 1ydg (more details) PDB Description: crystal structure of trp repressor binding protein wrba
PDB Compounds: (A:) Trp repressor binding protein WrbASCOP Domain Sequences for d1ydga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}
apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea
mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa
qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra
sirhqvrrqveltaklleggs
SCOP Domain Coordinates for d1ydga_:
Click to download the PDB-style file with coordinates for d1ydga_. (The format of our PDB-style files is described here.)
Timeline for d1ydga_:
d1ydga_ appears in SCOP 1.75A | d1ydga_ (click for larger image) d1ydga_ in context of chain d1ydga_ in context of PDB Domains from other chains: d1ydgb_, d1ydgc_, d1ydgd_, d1ydge_, d1ydgf_, d1ydgg_, d1ydgh_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |