Lineage for d1ydga1 (1ydg A:3-201)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. Protein Trp repressor binding protein WrbA [117475] (4 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries)
    Uniprot Q9RYU4
  8. Domain d1ydga1: 1ydg A:3-201 [116614]
    Other proteins in same PDB: d1ydga2, d1ydgb2, d1ydgc2, d1ydgd2, d1ydge2, d1ydge3, d1ydgf2, d1ydgg2, d1ydgh2
    Structural genomics target
    complexed with so4

Details for d1ydga1

PDB Entry: 1ydg (more details), 2 Å

PDB Description: crystal structure of trp repressor binding protein wrba
PDB Compounds: (A:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d1ydga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydga1 c.23.5.8 (A:3-201) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}
apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea
mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa
qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra
sirhqvrrqveltaklleg

SCOPe Domain Coordinates for d1ydga1 are not available.

Timeline for d1ydga1:

Domains from same chain:
(mouse over for more information)
d1ydga2
Domains from other chains:
(mouse over for more information)
d1ydgb1, d1ydgb2, d1ydgc1, d1ydgc2, d1ydgd1, d1ydgd2, d1ydge1, d1ydge2, d1ydge3, d1ydgf1, d1ydgf2, d1ydgg1, d1ydgg2, d1ydgh1, d1ydgh2