Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (3 families) |
Family d.20.1.1: Ubiquitin conjugating enzyme, UBC [54496] (1 protein) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (18 species) |
Species Human (Homo sapiens), ubch8 [TaxId:9606] [117850] (1 PDB entry) |
Domain d1y6lc_: 1y6l C: [116511] |
PDB Entry: 1y6l (more details), 1.85 Å
SCOP Domain Sequences for d1y6lc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y6lc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8} stsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfspd ypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadpl vgsiatqymtnraehdrmarqwtkryat
Timeline for d1y6lc_: