SCOP 1.71: Domain d1y6lc_: 1y6l C:

Lineage for d1y6lc_ (1y6l C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (3 families)

5. Family d.20.1.1: Ubiquitin conjugating enzyme, UBC [54496] (1 protein)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (18 species)

7. Species Human (Homo sapiens), ubch8 [TaxId:9606] [117850] (1 PDB entry)

8. Domain d1y6lc_: 1y6l C: [116511]

Details for d1y6lc_

PDB Entry: 1y6l, 1.85 Å

PDB Description: Human ubiquitin conjugating enzyme E2E2

SCOP Domain Sequences for d1y6lc_:

Sequence; same for both SEQRES and ATOM records:

>d1y6lc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8}
stsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfspd
ypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadpl
vgsiatqymtnraehdrmarqwtkryat

Timeline for d1y6lc_:

• d1y6lc_ is new in SCOP 1.71
  
• d1y6lc_ appears in SCOP 1.73
  
• d1y6lc_ appears in the current release, SCOPe 2.08, called d1y6lc1