Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (3 families) automatically mapped to Pfam PF03876 |
Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein) |
Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (4 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117777] (6 PDB entries) Uniprot P34087 |
Domain d1y14d2: 1y14 D:1-80 [116327] Other proteins in same PDB: d1y14a_, d1y14b1, d1y14c_, d1y14d1 |
PDB Entry: 1y14 (more details), 2.3 Å
SCOPe Domain Sequences for d1y14d2:
Sequence, based on SEQRES records: (download)
>d1y14d2 d.230.1.1 (D:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr ilptdgsaefnvkyravvfk
>d1y14d2 d.230.1.1 (D:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mffikdlslnitlpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqaefn vkyravvfk
Timeline for d1y14d2:
View in 3D Domains from other chains: (mouse over for more information) d1y14a_, d1y14b1, d1y14b2, d1y14c_ |