Lineage for d1y14a_ (1y14 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999332Superfamily a.60.8: HRDC-like [47819] (5 families) (S)
  5. 1999349Family a.60.8.2: RNA polymerase II subunit RBP4 (RpoF) [69044] (1 protein)
  6. 1999350Protein RNA polymerase II subunit RBP4 (RpoF) [69045] (3 species)
    includes the N-terminal heterodimerisation alpha-hairpin
  7. 1999351Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [116939] (1 PDB entry)
    Uniprot P20433 46-221
  8. 1999352Domain d1y14a_: 1y14 A: [116322]
    Other proteins in same PDB: d1y14b1, d1y14b2, d1y14d1, d1y14d2

Details for d1y14a_

PDB Entry: 1y14 (more details), 2.3 Å

PDB Description: Crystal structure of yeast subcomplex of Rpb4 and Rpb7
PDB Compounds: (A:) DNA-directed RNA polymerase II 32 kDa polypeptide

SCOPe Domain Sequences for d1y14a_:

Sequence, based on SEQRES records: (download)

>d1y14a_ a.60.8.2 (A:) RNA polymerase II subunit RBP4 (RpoF) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
elialnlsearlvikealverrrafkrsqkkhkkkhlkhenandettavededddldedd
vnaddddfmhsetrekelesidvlleqttggnnkdlkntmqyltnfsrfrdqetvgaviq
llkstglhpfevaqlgslacdtadeaktlipslnnkisddelerilkelsnletly

Sequence, based on observed residues (ATOM records): (download)

>d1y14a_ a.60.8.2 (A:) RNA polymerase II subunit RBP4 (RpoF) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
elialnlsearlvikealverrrafkrsqtrekelesidvlleqttggnnkdlkntmqyl
tnfsrfrdqetvgaviqllkstglhpfevaqlgslacdtadeaktlipslnnkisddele
rilkelsnletly

SCOPe Domain Coordinates for d1y14a_:

Click to download the PDB-style file with coordinates for d1y14a_.
(The format of our PDB-style files is described here.)

Timeline for d1y14a_: