![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries) Uniprot P34087 |
![]() | Domain d1y14b1: 1y14 B:81-171 [116323] Other proteins in same PDB: d1y14a_, d1y14b2, d1y14c_, d1y14d2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1y14 (more details), 2.3 Å
SCOPe Domain Sequences for d1y14b1:
Sequence, based on SEQRES records: (download)
>d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik srirvkiegcisqvssihaigsikedylgai
>d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnasyqssedvitiksrirv kiegcisqvssihaigsikedylgai
Timeline for d1y14b1:
![]() Domains from other chains: (mouse over for more information) d1y14a_, d1y14c_, d1y14d1, d1y14d2 |