SCOPe 2.06: Domain d1xxob_: 1xxo B:

Lineage for d1xxob_ (1xxo B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Hypothetical protein Rv1155 [117230] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [117231] (4 PDB entries)
   Uniprot O06553

8. Domain d1xxob_: 1xxo B: [116206]

Details for d1xxob_

PDB Entry: 1xxo, 1.8 Å

PDB Description: X-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase at 1.8 a resolution

PDB Compounds: (B:) hypothetical protein Rv1155

SCOPe Domain Sequences for d1xxob_:

Sequence; same for both SEQRES and ATOM records:

>d1xxob_ b.45.1.1 (B:) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]}
vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
vtdrrvlltlpishvyglppgmr

Timeline for d1xxob_:

• d1xxob_ first appeared in SCOP 1.71
  
• d1xxob_ appears in SCOPe 2.05
  
• d1xxob_ appears in SCOPe 2.07
  
• d1xxob_ appears in the current release, SCOPe 2.08