Lineage for d1xxhj2 (1xxh J:1-207)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1365733Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1365812Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
    contains additional alpha-helical domain after the family specific domains
  7. 1365813Species Escherichia coli [TaxId:562] [52712] (6 PDB entries)
    Uniprot P28631
  8. 1365823Domain d1xxhj2: 1xxh J:1-207 [116182]
    Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe1, d1xxhf1, d1xxhf2, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj1
    protein/DNA complex; complexed with ags, po4, zn

Details for d1xxhj2

PDB Entry: 1xxh (more details), 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex
PDB Compounds: (J:) DNA polymerase III, delta prime subunit

SCOPe Domain Sequences for d1xxhj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxhj2 c.37.1.20 (J:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
tmsqdallaalrlsagspgaalalfqg

SCOPe Domain Coordinates for d1xxhj2:

Click to download the PDB-style file with coordinates for d1xxhj2.
(The format of our PDB-style files is described here.)

Timeline for d1xxhj2: