Lineage for d1xxha2 (1xxh A:1-211)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1365733Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1365826Protein delta subunit of DNA polymerase III, N-domain [64033] (1 species)
  7. 1365827Species Escherichia coli [TaxId:562] [64034] (5 PDB entries)
    Uniprot P28630
  8. 1365832Domain d1xxha2: 1xxh A:1-211 [116164]
    Other proteins in same PDB: d1xxha1, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe1, d1xxhe2, d1xxhf1, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj1, d1xxhj2
    protein/DNA complex; complexed with ags, po4, zn

Details for d1xxha2

PDB Entry: 1xxh (more details), 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex
PDB Compounds: (A:) DNA Polymerase III, DELTA SUBUNIT

SCOPe Domain Sequences for d1xxha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxha2 c.37.1.20 (A:1-211) delta subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
laqalerlsllwpdgkltlprveqavndaah

SCOPe Domain Coordinates for d1xxha2:

Click to download the PDB-style file with coordinates for d1xxha2.
(The format of our PDB-style files is described here.)

Timeline for d1xxha2: