Lineage for d1xxhe1 (1xxh E:208-334)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1274707Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 1274708Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 1274709Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 1274710Protein delta prime subunit [48021] (1 species)
  7. 1274711Species Escherichia coli [TaxId:562] [48022] (4 PDB entries)
    Uniprot P28631
  8. 1274714Domain d1xxhe1: 1xxh E:208-334 [116171]
    Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj2
    protein/DNA complex; complexed with ags, po4, zn

Details for d1xxhe1

PDB Entry: 1xxh (more details), 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex
PDB Compounds: (E:) DNA polymerase III, delta prime subunit

SCOPe Domain Sequences for d1xxhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxhe1 a.80.1.1 (E:208-334) delta prime subunit {Escherichia coli [TaxId: 562]}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrhhgaaqvtn
vdvpglvaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgv
vlpvphl

SCOPe Domain Coordinates for d1xxhe1:

Click to download the PDB-style file with coordinates for d1xxhe1.
(The format of our PDB-style files is described here.)

Timeline for d1xxhe1: