Lineage for d1xwkb2 (1xwk B:1-84)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. Protein Class mu GST [81359] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [52867] (16 PDB entries)
    Uniprot P09488 ! Uniprot P28161
  8. Domain d1xwkb2: 1xwk B:1-84 [116129]
    Other proteins in same PDB: d1xwka1, d1xwkb1, d1xwkc1
    complexed with gdn

Details for d1xwkb2

PDB Entry: 1xwk (more details), 2.3 Å

PDB Description: 2.3 angstrom resolution crystal structure of human glutathione s- transferase m1a-1a complexed with glutathionyl-s-dinitrobenzene
PDB Compounds: (B:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d1xwkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwkb2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOPe Domain Coordinates for d1xwkb2 are not available.

Timeline for d1xwkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xwkb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1xwka1, d1xwka2, d1xwkc1, d1xwkc2