Lineage for d1xwkc1 (1xwk C:85-217)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996816Protein Class mu GST [81348] (3 species)
  7. 1996824Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
    Uniprot P09488 P28161
  8. 1996836Domain d1xwkc1: 1xwk C:85-217 [116130]
    Other proteins in same PDB: d1xwka2, d1xwkb2, d1xwkc2
    complexed with gdn

Details for d1xwkc1

PDB Entry: 1xwk (more details), 2.3 Å

PDB Description: 2.3 angstrom resolution crystal structure of human glutathione S-transferase M1A-1A complexed with glutathionyl-S-dinitrobenzene
PDB Compounds: (C:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d1xwkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwkc1 a.45.1.1 (C:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOPe Domain Coordinates for d1xwkc1:

Click to download the PDB-style file with coordinates for d1xwkc1.
(The format of our PDB-style files is described here.)

Timeline for d1xwkc1: