Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.23: ApaG-like [110069] (2 families) |
Family b.1.23.1: ApaG-like [110070] (1 protein) Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit |
Protein ApaG [110071] (4 species) |
Species Vibrio cholerae [TaxId:666] [117065] (1 PDB entry) Uniprot Q9KUS3 |
Domain d1xvsb_: 1xvs B: [116096] Structural genomics target complexed with gol |
PDB Entry: 1xvs (more details), 2.01 Å
SCOPe Domain Sequences for d1xvsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvsb_ b.1.23.1 (B:) ApaG {Vibrio cholerae [TaxId: 666]} mdvslpcikiqvqtryieeqsnpeyqrfvfaylitiknlssqtvqlmsrrwlitdadgkq tvvegdgvvgeqprikandeytyssgtaldtpvgvmqgqylmideqgesftveiepfrla vphv
Timeline for d1xvsb_: