Lineage for d1xsid1 (1xsi D:666-773)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565389Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 1565390Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family) (S)
  5. 1565391Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)
  6. 1565392Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)
  7. 1565393Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
    Uniprot P31434
  8. 1565409Domain d1xsid1: 1xsi D:666-773 [115939]
    Other proteins in same PDB: d1xsia2, d1xsia3, d1xsia4, d1xsib2, d1xsib3, d1xsib4, d1xsic2, d1xsic3, d1xsic4, d1xsid2, d1xsid3, d1xsid4, d1xsie2, d1xsie3, d1xsie4, d1xsif2, d1xsif3, d1xsif4
    complexed with acy, mpo, so4

Details for d1xsid1

PDB Entry: 1xsi (more details), 2.2 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (D:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsid1 b.150.1.1 (D:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh

SCOPe Domain Coordinates for d1xsid1:

Click to download the PDB-style file with coordinates for d1xsid1.
(The format of our PDB-style files is described here.)

Timeline for d1xsid1: