![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.11: YicI N-terminal domain-like [117139] (2 proteins) |
![]() | Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117141] (5 PDB entries) Uniprot P31434 |
![]() | Domain d1xsic2: 1xsi C:1-247 [115936] Other proteins in same PDB: d1xsia1, d1xsia3, d1xsia4, d1xsib1, d1xsib3, d1xsib4, d1xsic1, d1xsic3, d1xsic4, d1xsid1, d1xsid3, d1xsid4, d1xsie1, d1xsie3, d1xsie4, d1xsif1, d1xsif3, d1xsif4 complexed with acy, mpo, so4 |
PDB Entry: 1xsi (more details), 2.2 Å
SCOPe Domain Sequences for d1xsic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsic2 b.30.5.11 (C:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]} mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf vidgptp
Timeline for d1xsic2: