SCOP 1.73: Domain d1xsca_: 1xsc A:

Lineage for d1xsca_ (1xsc A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (7 families)

5. Family d.113.1.1: MutT-like [55812] (16 proteins)

6. Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118084] (3 PDB entries)

8. Domain d1xsca_: 1xsc A: [115924]
   complexed with atp; mutant

Details for d1xsca_

PDB Entry: 1xsc

PDB Description: structure of the nudix enzyme ap4a hydrolase from homo sapiens (e63a mutant) in complex with atp

PDB Compounds: (A:) Bis(5'-nucleosyl)-tetraphosphatase

SCOP Domain Sequences for d1xsca_:

Sequence; same for both SEQRES and ATOM records:

>d1xsca_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]}
gplgsmalracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddleta
lratqeeagieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayr
wlgleeacqlaqfkemkaalqeghqflcsieal

Timeline for d1xsca_:

• d1xsca_ first appeared in SCOP 1.71
  
• d1xsca_ appears in SCOP 1.75
  
• d1xsca_ appears in the current release, SCOPe 2.08, called d1xsca1