Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (5 families) |
Family d.113.1.1: MutT-like [55812] (10 proteins) |
Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [118084] (3 PDB entries) |
Domain d1xsca_: 1xsc A: [115924] complexed with atp; mutant |
PDB Entry: 1xsc (more details)
SCOP Domain Sequences for d1xsca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsca_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens)} gplgsmalracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddleta lratqeeagieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayr wlgleeacqlaqfkemkaalqeghqflcsieal
Timeline for d1xsca_: