![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118084] (3 PDB entries) Uniprot P50583 |
![]() | Domain d1xsca1: 1xsc A:7-152 [115924] Other proteins in same PDB: d1xsca2, d1xsca3 complexed with atp; mutant |
PDB Entry: 1xsc (more details)
SCOPe Domain Sequences for d1xsca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsca1 d.113.1.1 (A:7-152) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} alracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalratqe eagieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlglee acqlaqfkemkaalqeghqflcsiea
Timeline for d1xsca1: