Lineage for d1xsca1 (1xsc A:7-152)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971526Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species)
  7. 2971527Species Human (Homo sapiens) [TaxId:9606] [118084] (3 PDB entries)
    Uniprot P50583
  8. 2971530Domain d1xsca1: 1xsc A:7-152 [115924]
    Other proteins in same PDB: d1xsca2, d1xsca3
    complexed with atp; mutant

Details for d1xsca1

PDB Entry: 1xsc (more details)

PDB Description: structure of the nudix enzyme ap4a hydrolase from homo sapiens (e63a mutant) in complex with atp
PDB Compounds: (A:) Bis(5'-nucleosyl)-tetraphosphatase

SCOPe Domain Sequences for d1xsca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsca1 d.113.1.1 (A:7-152) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]}
alracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalratqe
eagieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlglee
acqlaqfkemkaalqeghqflcsiea

SCOPe Domain Coordinates for d1xsca1:

Click to download the PDB-style file with coordinates for d1xsca1.
(The format of our PDB-style files is described here.)

Timeline for d1xsca1: