Lineage for d1xsba_ (1xsb A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1216197Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1216198Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1216199Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 1216271Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species)
  7. 1216272Species Human (Homo sapiens) [TaxId:9606] [118084] (3 PDB entries)
    Uniprot P50583
  8. 1216273Domain d1xsba_: 1xsb A: [115923]
    mutant

Details for d1xsba_

PDB Entry: 1xsb (more details)

PDB Description: structure of the nudix enzyme ap4a hydrolase from homo sapiens (e63a mutant) in complex with atp. no atp restraints included
PDB Compounds: (A:) Bis(5'-nucleosyl)-tetraphosphatase

SCOPe Domain Sequences for d1xsba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]}
gplgsmalracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddleta
lratqeeagieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayr
wlgleeacqlaqfkemkaalqeghqflcsieal

SCOPe Domain Coordinates for d1xsba_:

Click to download the PDB-style file with coordinates for d1xsba_.
(The format of our PDB-style files is described here.)

Timeline for d1xsba_: