![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118084] (3 PDB entries) Uniprot P50583 |
![]() | Domain d1xsba1: 1xsb A:6-152 [115923] Other proteins in same PDB: d1xsba2, d1xsba3 mutant |
PDB Entry: 1xsb (more details)
SCOPe Domain Sequences for d1xsba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsba1 d.113.1.1 (A:6-152) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} malracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalratq eeagieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgle eacqlaqfkemkaalqeghqflcsiea
Timeline for d1xsba1: