| Class b: All beta proteins [48724] (180 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
| Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
| Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species) |
| Species Escherichia coli [TaxId:562] [117336] (6 PDB entries) Uniprot P28248 |
| Domain d1xs6d_: 1xs6 D: [115916] complexed with dut, mg; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1xs6 (more details), 2 Å
SCOPe Domain Sequences for d1xs6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xs6d_ b.85.4.1 (D:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]}
mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
nqqgavasridkd
Timeline for d1xs6d_: