Lineage for d1xs6a_ (1xs6 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)
  7. Species Escherichia coli [TaxId:562] [117336] (6 PDB entries)
    Uniprot P28248
  8. Domain d1xs6a_: 1xs6 A: [115913]
    complexed with dut, mg; mutant

Details for d1xs6a_

PDB Entry: 1xs6 (more details), 2 Å

PDB Description: dCTP deaminase from Escherichia coli. E138A mutant enzyme in complex with dUTP
PDB Compounds: (A:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d1xs6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xs6a_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]}
mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
nqqgavasridkd

SCOPe Domain Coordinates for d1xs6a_ are not available.

Timeline for d1xs6a_:

Domains from other chains:
(mouse over for more information)
d1xs6b_, d1xs6c_, d1xs6d_, d1xs6e_, d1xs6f_