Lineage for d1xr0b_ (1xr0 B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805395Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (12 proteins)
    Pfam PF00640
  6. 805428Protein FGFR substrate 2 (SNT-1) [117257] (1 species)
  7. 805429Species Human (Homo sapiens) [TaxId:9606] [117258] (1 PDB entry)
    Uniprot Q7LDQ6 11-129
  8. 805430Domain d1xr0b_: 1xr0 B: [115858]
    complexed with BFGFR-1 peptide (Uniprot Q04589 409-430), chain A

Details for d1xr0b_

PDB Entry: 1xr0 (more details)

PDB Description: structural basis of snt ptb domain interactions with distinct neurotrophic receptors
PDB Compounds: (B:) FGFR signalling adaptor SNT-1

SCOP Domain Sequences for d1xr0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xr0b_ b.55.1.2 (B:) FGFR substrate 2 (SNT-1) {Human (Homo sapiens) [TaxId: 9606]}
mgsdtvpdnhrnkfkvinvdddgnelgsgimeltdtelilytrkrdsvkwhylclrrygy
dsnlfsfesgrrcqtgqgifafkcaraeelfnmlqeimqnnsinvveepvvernnhqtel
evprtprtp

SCOP Domain Coordinates for d1xr0b_:

Click to download the PDB-style file with coordinates for d1xr0b_.
(The format of our PDB-style files is described here.)

Timeline for d1xr0b_: