![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
![]() | Family a.96.1.6: AgoG-like [116976] (2 proteins) automatically mapped to Pfam PF09171 |
![]() | Protein 8-oxoguanine DNA glycosylase, AgoG [116977] (1 species) |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [116978] (2 PDB entries) Uniprot Q8ZVK6 # PAE2237 |
![]() | Domain d1xqoa_: 1xqo A: [115853] |
PDB Entry: 1xqo (more details), 1.03 Å
SCOPe Domain Sequences for d1xqoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xqoa_ a.96.1.6 (A:) 8-oxoguanine DNA glycosylase, AgoG {Pyrobaculum aerophilum [TaxId: 13773]} aaesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyrl tgkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnled lgltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltwc aglidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpkev ialfqwrggcrpp
Timeline for d1xqoa_: