SCOPe 2.08: Domain d1xqoa_: 1xqo A:

Lineage for d1xqoa_ (1xqo A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.6: AgoG-like [116976] (2 proteins)
   automatically mapped to Pfam PF09171

6. Protein 8-oxoguanine DNA glycosylase, AgoG [116977] (1 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [116978] (2 PDB entries)
   Uniprot Q8ZVK6 # PAE2237

8. Domain d1xqoa_: 1xqo A: [115853]

Details for d1xqoa_

PDB Entry: 1xqo, 1.03 Å

PDB Description: crystal structure of native pa-agog, 8-oxoguanine dna glycosylase from pyrobaculum aerophilum

PDB Compounds: (A:) 8-oxoguanine DNA glycosylase

SCOPe Domain Sequences for d1xqoa_:

Sequence; same for both SEQRES and ATOM records:

>d1xqoa_ a.96.1.6 (A:) 8-oxoguanine DNA glycosylase, AgoG {Pyrobaculum aerophilum [TaxId: 13773]}
aaesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyrl
tgkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnled
lgltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltwc
aglidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpkev
ialfqwrggcrpp

Timeline for d1xqoa_:

• d1xqoa_ first appeared in SCOP 1.71
  
• d1xqoa_ appears in SCOPe 2.07