Lineage for d1xqoa_ (1xqo A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003278Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2003279Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2003409Family a.96.1.6: AgoG-like [116976] (2 protein domains)
    automatically mapped to Pfam PF09171
  6. 2003410Protein 8-oxoguanine DNA glycosylase, AgoG [116977] (1 species)
  7. 2003411Species Pyrobaculum aerophilum [TaxId:13773] [116978] (2 PDB entries)
    Uniprot Q8ZVK6 # PAE2237
  8. 2003412Domain d1xqoa_: 1xqo A: [115853]

Details for d1xqoa_

PDB Entry: 1xqo (more details), 1.03 Å

PDB Description: Crystal structure of native Pa-AGOG, 8-oxoguanine DNA glycosylase from Pyrobaculum aerophilum
PDB Compounds: (A:) 8-oxoguanine DNA glycosylase

SCOPe Domain Sequences for d1xqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqoa_ a.96.1.6 (A:) 8-oxoguanine DNA glycosylase, AgoG {Pyrobaculum aerophilum [TaxId: 13773]}
aaesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyrl
tgkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnled
lgltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltwc
aglidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpkev
ialfqwrggcrpp

SCOPe Domain Coordinates for d1xqoa_:

Click to download the PDB-style file with coordinates for d1xqoa_.
(The format of our PDB-style files is described here.)

Timeline for d1xqoa_: