Lineage for d1xqoa_ (1xqo A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541438Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 541439Superfamily a.96.1: DNA-glycosylase [48150] (6 families) (S)
  5. 541511Family a.96.1.6: AgoG-like [116976] (2 proteins)
  6. 541512Protein 8-oxoguanine DNA glycosylase, AgoG [116977] (1 species)
  7. 541513Species Pyrobaculum aerophilum [TaxId:13773] [116978] (2 PDB entries)
  8. 541514Domain d1xqoa_: 1xqo A: [115853]

Details for d1xqoa_

PDB Entry: 1xqo (more details), 1.03 Å

PDB Description: crystal structure of native pa-agog, 8-oxoguanine dna glycosylase from pyrobaculum aerophilum

SCOP Domain Sequences for d1xqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqoa_ a.96.1.6 (A:) 8-oxoguanine DNA glycosylase, AgoG {Pyrobaculum aerophilum}
aaesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyrl
tgkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnled
lgltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltwc
aglidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpkev
ialfqwrggcrpp

SCOP Domain Coordinates for d1xqoa_:

Click to download the PDB-style file with coordinates for d1xqoa_.
(The format of our PDB-style files is described here.)

Timeline for d1xqoa_: